Monday, August 23, 2010

Articles on XMRV

  • Daniel J. Choe,
  • Kristy R. Brown,
  • Harshwardhan M. Thaker,
  • and Ila R. Singh
  1. XMRV is present in malignant prostatic epithelium and is associated with prostate cancer, especially high-grade tumors PNAS 2009 106 (38) 16351-16356; published ahead of print September 8, 2009, doi:10.1073/pnas.0906922106
  2. ...Text Creating an Infectious Clone of XMRV. Overlapping partial clones AM-29 and...0906922106 2 of 7 Fig. S1. Detection of XMRV DNA in prostate tissues by a qPCR and...standard reaction containing 500 copies of XMRV proviral DNA diluted in normal prostatic...
  1. OPEN ACCESS ARTICLE
    • Melvyn W. Yap,
    • Rui Pedro Galão,
    • Stuart J. D. Neil,
    • and Kate N. Bishop
    1. Susceptibility of xenotropic murine leukemia virus-related virus (XMRV) to retroviral restriction factors PNAS 2010 107 (11) 5166-5171; published ahead of print March 1, 2010, doi:10.1073/pnas.0913650107
    2. ...We thank Robert Silverman for the VP62 XMRV clone, Michael Malim for the HA-tagged...Constructs. VP62 xenotropic MLV-related virus (XMRV) clonewasakindgiftofRobertSilverman(LernerResearchInstitute...0913650107 2 of 3 Fig. S4. Sensitivity of XMRV to murine tetherin. XMRV packaging an...
    1. Sanggu Kim,
    2. Seunghee Hong,
    3. Jaydip Das Gupta,
    4. Krishnamurthy Malathi,
    5. Eric A. Klein,
    6. Don Ganem,
    7. Joseph L. DeRisi,
    8. Samson A. Chow,
    9. and Robert H. Silverman
    10. From the Cover: An infectious retrovirus susceptible to an IFN antiviral pathway from human prostate tumors PNAS 2007 104 (5) 1655-1660; published ahead of print January 18, 2007, doi:10.1073/pnas.0610291104
    11. ...murine leukemia virus-related virus (XMRV), in prostate cancer tissue from patients...The assay for cloning and sequencing XMRV integration sites was essentially identical...sequence of the molecular viral clone of XMRV VP62 reported in this paper has been...
    1. OPEN ACCESS ARTICLE
    • Martial Renard,
    • Marianne Mangeney,
    • Claire Letzelter,
    • Aurélien Richaud,
    • Bertrand Ducos,
    • Isabelle Bouallaga,
    • and Thierry Heidmann
    1. Retroviral infection in vivo requires an immune escape virulence factor encrypted in the envelope protein of oncoretroviruses PNAS 2010 107 (8) 3782-3787; published ahead of print February 8, 2010, doi:10.1073/pnas.0913122107
    2. ...vector opened with the same enzymes. The XMRV Env ectodomain encoding the DNA sequence...counterpart using primer pair S13S14. The DM XMRV Env ectodomain was introduced back into...MAAVQDDLKEVEKSITNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHTGLV XMRV QAAIHTDLGALEKSVSALEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHTGVV...
    1. A new human retrovirus associated with prostate cancer PNAS 2007 104 (5) 1449-1450; published ahead of print January 23, 2007, doi:10.1073/pnas.0610912104
    2. ...Retrovirus Breast cancer No ? XMRV Retrovirus Prostate cancer No...deduced the sequence for the virus [named XMRV for xenotropic murine leukemia virus...questions. In particular, the detection of XMRV was PCR-based, which raised the inevitable...
    1. ...murine leukemia virus-related virus (XMRV), in prostate cancers and found that...RNase L gene were more susceptible to XMRV infection than those without the variation...individuals with prostate cancer and found XMRV in 27% of cases. The virus was more...
    1. Babal Kant Jha,
    2. Beihua Dong,
    3. Jaydip Das Gupta,
    4. Kenneth M. Silverman,
    5. Hongxia Mao,
    6. Hiro Sawai,
    7. Akiko O. Nakamura,
    8. Amiya K. Banerjee,
    9. Andrei Gudkov,
    10. and Robert H. Silverman
    11. Small-molecule activators of RNase L with broad-spectrum antiviral activity PNAS 2007 104 (23) 9585-9590; published ahead of print May 29, 2007, doi:10.1073/pnas.0700590104
    12. ...images were captured by using a fluorescence microscope (DM IRB; Leica, Wetzlar, Germany). DU145 cells were infected with XMRV in FBS-free RPMI medium 1640 with 8 mug/ml polybrene for 3 h, followed by washing with PBS. Cells were treated in triplicate...
    1. OPEN ACCESS ARTICLE
    • Alexander L. Greninger,
    • Kimberly Kanada,
    • Thomas Kwok,
    • Kael F. Fischer,
    • Charles Runckel,
    • Janice K. Louie,
    • Carol A. Glaser,
    • Shigeo Yagi,
    • David P. Schnurr,
    • Tom D. Haggerty,
    • Julie Parsonnet,
    • Don Ganem,
    • and Joseph L. DeRisi
    1. Identification of cardioviruses related to Theiler's murine encephalomyelitis virus in human infections PNAS 2008 105 (37) 14124-14129; published ahead of print September 3, 2008, doi:10.1073/pnas.0805968105
    1. OPEN ACCESS ARTICLE
     

    No comments: